Is the following chunk of protein sequence, cause any mutation. I didn't find enough information about this protein. I know it easy to search for it using available database, but the issue here I didn't find source with full details.
GEMVTKAKCKFCYKLYVYQPGGPTSQLNRHLDKCTAYQNKLANAKSKVAQGTISFALDDGSLVVNPTEYD LDMEDDFSLSLSSEDGGSQGEDEVHNAKRGVKRAKGDVPLSPSKCKVKRVKRADCWKYFKVVEVQSKKKF GEMVTKAKCKFCYKLYVKRAKGDVPLSPSKCKVKRVKRADCWKYFKVVEVISFALDDGSLVVNPTEYD HDHTRNLIAKMIIVHEYSLRMVEHRWFNILMKWMNN
what was the result of aligning this protein against the database?
maybe it is uncharacterized protein of maize or rice?
I used blastp, and it gave me long matching
this is the first one with the following information 236 236 78% 1e-73 59% CAE75980.1 wich is : B1160F02.11 [Oryza sativa Japonica Group] GenBank: CAE75980.1
the second one 243 243 85% 3e-72 58% BAF04701.2 the third one 182 182 78% 7e-50 47% XP_015624332.1 I don't know which one will be the accurate one regarding the coverage %. Also there are 4 others befor those in the blast list and the first one is uncharacterized and the other 3 are hypotheticals
How are we supposed to help you with a protein that you do not seem to know much about either :)
Have you tried blat'ing the sequence using the UCSC BLAT search?
http://genome.ucsc.edu/cgi-bin/hgBlat
That appears to be a plant sequences based on a couple of posts above.
So the question here what is the specific name of this protein. if the named or accession number is known it will be easy to look for more details about it
No offense but this is not an exercise/homework question, correct?
No it is not. I am just curious about it. what I found so far it is uncharacterized corn protien
Try Blast search over at Uniprot.org. Appears to be a plant (rice) protein.
Do you mean for Japanese rice
Oryza genus at least (which will include rice). Based on the hits you only appear to have a fragment of the total protein (~40%).
Why do you expect this to be mutagenic and to which organism?
Based on the domain for it which include Zinc finger which play a role for binding DNA, I expect may cause mutation, but so far I don't know what is it.
Yeah. For whatever reason, I just assume every protein in the universe is human. Need my caffeine fix.