I have the following sequence;
IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMI
I used three tools/methods from the Immune Epitope Database (IEDB) to predict antigenic peptides from this sequence. So, each of the method generated a list of peptides. Thus I have three lists for the given sequence. The principle is; I will find the peptide that is common or overlapping in all three lists.
Here in the linked table, I found a peptide DSRCPTQ common and overlapping in all three lists. But I did it manually.
Is it possible to find peptide in such a way through UNIX command in ubuntu terminal? If yes, then would you please suggest me the way?
It is working nicely. Thank you very much.