Entering edit mode
4.6 years ago
sharmatina189059
▴
110
Dear all I am using blast to align my sequences bot with command line as well as graphically. I want to know that my query sequence which is mentioned below has a total length of 169aa. I am aligning it with two sequence mentioned below. While aligning the blast results shows two different length of query sequence. WHy? It is showing 160 length while aligning to 1st sequence with default parameters and with 2nd sequence the query length is 169. Can you please tell me why it is happening? Query protein ID WP_000009660.1
>seq1_160_length
MKKLLMLLCLGVSSHSVWANTLVEMQTNLGNIEIELYDDKAPMSVNNFKGYIKSGFYKETIFHRVIPGFMAQGGGMTTNMQEKTTRAPIKNEAGNGIANTRGTLAMARTSNPDSATSQFFINVADNNFLNRSPGNPGYAVFGKVVKGMDVVDRIVQAPTSNYGMHQNVPKQPIKIVDKKSKILKNKLTI
>seq2_169_length
MSFPQVELNTNKGRIVLELNTEKAPKTAANFLEYVRDGFYDGVIFHRVIDGFMIQGGGFDENFKEKATRDAIENEADNGLSNDVGTIAMARTQAPHSASAQFFINVKNNSFLNHTSKTAQGWGYAVFGKVIEGMDVVEAIKGVRTGNRGYHADVPLENVVIESAKIISE
It is possibly just showing the part that is aligned. Are you referring to pair-wise alignment results?
Yes. Can you please show me example. I really could not understand how they are calculating alignment length.