UniProt protein amino acid

Question

[Rob]

Hello I have tblastn results (for 2 fasta files), I dont know how to locate the aligned subject protein sequence. how should I use this sequence to identify the corresponding integrase protein record in UniProtKB. (I want to find one with 100% identity).

I want to use UniProt to compare human IGRP protein and the integrase that is an IGRP-mimic.

Can anyone help me with this? I am stuck.

[supertech]

Can you give example sequences? What are you starting with what are you getting. What step exactly you are stuck at?

[Rob]

Hello thanks for responding. I dont know what approach to take.

This is my reslut from tBLASTn:

saccver Subject accession dot version (database hit): NODE_513_length_2816_cov_3.16407
qstart  Start of alignment in query:1
qend End of alignment in query:108
sstart  Start of alignment in subject (database hit):526
send End of alignment in subject (database hit): 203
sallseqid   All subject Seq-id(s), separated by a ';' : NODE_513_length_2816_cov_3.16407

qseq    Aligned part of query sequence:
MDKIRYRLVYNRQKKLNKQGTAFVQIEAYLNQRKIYLKTNVYLKPECWSREGAQVINHPQSNELNAMLYEYILYLQGIELGYWKRGIPATLSLLKDAVKKKSAVNISF

sseq    Aligned part of subject sequence:
MDKIRYRLVYNRQNTLNRQGTTLVQVEAYLNQRKIYLKTNVYLKPECWSREGAQVINHPQSNELNAMLYEYILYLQGIELGYWKRGIPATLSLLKDAVKKKSAVNVSF

Answer 1

[supertech]

You can use this link to convert GenBank Accession IDs to UniProt IDs. You could find GenBank accession numbers by BLAST and search corresponding UnitProKB. However, I am not sure if all the GenBank IDs are represented in UnitProKB.

Looks like you could also do Unitpro BLAST in Uniprot directly. Your first protein seq returns hits.

[Rob]

Thanks you for responding. I found a way for this but I am not sure if it is right way. I just BLAST for the subject sequence and found 2 protein name with 100% identity. one was the Integrase I wanted.